PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00017.1.g00420.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 669aa    MW: 74223.4 Da    PI: 10.5756
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00017.1.g00420.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.83e-19412459148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT++Edell+d+v+q+G g+W+++++  g++R++k+c++rw +yl
  Zjn_sc00017.1.g00420.1.am.mk 412 KGPWTAQEDELLLDYVRQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 459
                                   79********************************************97 PP

2Myb_DNA-binding49.21.2e-15465509147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  Zjn_sc00017.1.g00420.1.am.mk 465 RGKITPQEESVILQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 509
                                   8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.538407459IPR017930Myb domain
SuperFamilySSF466891.09E-29410506IPR009057Homeodomain-like
SMARTSM007177.2E-17411461IPR001005SANT/Myb domain
PfamPF002491.1E-17412459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-23413466IPR009057Homeodomain-like
CDDcd001671.18E-12414459No hitNo description
PROSITE profilePS5129424.907460514IPR017930Myb domain
SMARTSM007174.4E-15464512IPR001005SANT/Myb domain
PfamPF002492.1E-13465509IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-23467512IPR009057Homeodomain-like
CDDcd001673.25E-10469510No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MPRSRIKTRA NRLVFHSKST DSGGLSDPKL HGFHESNVQR GMHATSRDHE RLCSGVCLER  60
AALVGGLPDS SLFALFPSVS IDPSRSEDVI ASYPSITAPT PVPVYNSRAH ALALVSLCCW  120
GRGRHKPSNQ RPVGPRRTRA HWWWRRGSDR STFRCGTRPR GGVRGAWCVV VGLGARHRSR  180
VDDEAVPGPD DGGQGRATEG STRGPDVARA ERPGDGDVAR SKARSNNGGF THRGGGGRPG  240
RFLPMATAAA TQTSREQRFF RCEPRRLGFF RFLLTLEATG RGKAAARCSA SHAQVGTKPE  300
STISADALDK RKRTKGPRQT QVYCAGAEAL SPRQGAPELG PRCYAIAAEA ALSAEIPRFT  360
SPRRLARSLR RRAATVQVRK VDRLARSLRG EGEVGMMDGQ FGWGREEGGW RKGPWTAQED  420
ELLLDYVRQH GEGRWNSVSK LTGLKRSGKS CRLRWVNYLR PDLKRGKITP QEESVILQLH  480
ALWGNRWSTI ARSLPGRTDN EIKNYWRTHF KKGKPSKNIE RARARFLKQR REMQSQMLIQ  540
GQEQQQQQMQ QLKQPGDHDH AATRQQAAPA VSSPAPQHED LQMMLLDMDD LLYQLCPMSM  600
SSCSSSYYHF HGGSVSASAA SEGSSEDQLD GGDTWGWGSL WNLDDMVDDI DGGWDSSCPW  660
LQEQGLAFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-244125127106B-MYB
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0992831e-135AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBankAK1118071e-135AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.14e-61myb domain protein 79